PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK00738.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 160aa    MW: 18266.2 Da    PI: 6.514
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK00738.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.28.1e-134084347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
        PK00738.2 40 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 84
                     8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4543389IPR017930Myb domain
SMARTSM007173.2E-103787IPR001005SANT/Myb domain
SuperFamilySSF466892.73E-163890IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-193888IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-113983IPR009057Homeodomain-like
PfamPF002493.1E-114084IPR001005SANT/Myb domain
CDDcd001673.02E-104085No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
XNLKIRIITG DSANNYFCWL YHTRQFVFGI SINFKFSGVP WTEEEHRMFL LGLQKLGKGD  60
WRGIARNYVI SRTPTQVASH AQKYFIRQTN VSRRKRRSSL FDIIADEAAD ASMVPRDFLS  120
VNHPQQEVLS DNTLPDPPAL DEECESMDST NSNDGEPAPP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR7515541e-166FR751554.1 Humulus lupulus mRNA for myb transcription factor (myb4 gene), cultivar Osvald's 72, clone 3363.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104868.14e-76Transcription factor
TrEMBLG7ZLA34e-82G7ZLA3_HUMLU; Myb transcription factor
STRINGPOPTR_0001s15510.12e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1686178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.13e-52MYB_related family protein